PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100120480131
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 370aa    MW: 40190.4 Da    PI: 9.4611
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100120480131genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.46.7e-28103156256
                       G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                    +++WtpeLH++Fv+aveqL G +kA+P++ilelm++++Lt+++v+SHLQkYR++
  Ote100120480131|100120480131 103 GKVDWTPELHRQFVQAVEQL-GVDKAVPSKILELMGIDCLTRHNVASHLQKYRSH 156
                                   5899****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.32899158IPR017930Myb domain
SuperFamilySSF466892.6E-19100159IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.1E-27100159IPR009057Homeodomain-like
TIGRFAMsTIGR015575.6E-26102156IPR006447Myb domain, plants
PfamPF002492.3E-8105154IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MDPRISAEIS SSAGEESEMS TEATGSVQVD KVREGNISIK EDKTPAASAS ASASNHGSGS  60
SIIQGEEPVS TREDLVADEY PRKVDKGRKS SAQINKVSGK KKGKVDWTPE LHRQFVQAVE  120
QLGVDKAVPS KILELMGIDC LTRHNVASHL QKYRSHRKHM LARESEVATW SRKRQLYRST  180
GSTRKNDANS WVVPTTGFPP VTSVSRSRPI HVWGHPSPNQ SLVYMWPSHL ASSPSPPPWA  240
AGHPPPRPLP GDPSFWNYHH QDVPAQGMVC YPSHYPQPTF ASPPVPGLPP SSMYRAAPSI  300
GVPVNVPGQK MAQPVQDSHL QSTESIDAVI GDVLSKPWLP LPLGLKPPSV DSVVVELQRQ  360
GISKIPPTCA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A5e-1798154157ARR10-B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011100407.11e-153PREDICTED: probable transcription factor GLK1
SwissprotQ9SIV34e-71GLK1_ARATH; Transcription activator GLK1
TrEMBLA0A022QJU01e-151A0A022QJU0_ERYGU; Uncharacterized protein
STRINGVIT_12s0028g03100.t011e-112(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA25322356